DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Elane

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:270 Identity:72/270 - (26%)
Similarity:122/270 - (45%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASRTEAAV--------PRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHC 78
            :|||.||:        |... |.||.||.|....:|:..||:|:..|.|||::::.|:.::||||
Mouse     7 SSRTLAAMLLALFLGGPALA-SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHC 70

  Fly    79 IDG------------HEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTA 131
            ::|            |:.:.:|.|.:..|:.|           |::: .:|.:.:..|:.::: .
Mouse    71 VNGLNFRSVQVVLGAHDLRRQERTRQTFSVQR-----------IFEN-GFDPSQLLNDIVIIQ-L 122

  Fly   132 DGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDL 196
            :|:.::. ..|...:||..|:.:.:..|.:..|||.:.|:.| ..|||:...| ||....|...:
Mouse   123 NGSATIN-ANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRP-SPSVLQELNV-TVVTNMCRRRV 184

  Fly   197 RHHGGVTEAMFCAAA--RNTDACQGDSGGPISAQGTLIGIVSW--GVGCADPYYPGVYTRLAHPT 257
            .         .|...  |....|.||||||:.....:.||.|:  | ||....||..:..:|.  
Mouse   185 N---------VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGLYPDAFAPVAE-- 237

  Fly   258 IRRWIRLLTK 267
            ...||..:.:
Mouse   238 FADWINSIIR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 63/241 (26%)
Tryp_SPc 37..263 CDD:238113 64/241 (27%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 63/241 (26%)
Tryp_SPc 29..245 CDD:238113 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.