DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG34130

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:259 Identity:58/259 - (22%)
Similarity:100/259 - (38%) Gaps:74/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NGREATEG--QFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTL-------RQG 94
            ||...|.|  ..|:.|.:......:||||.||:.:|:|:|:|:..|..|....::       ||.
  Fly    44 NGIRRTSGGHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQD 108

  Fly    95 SIMRTSGGTVQPVKAIYKHPAYDRADMNF-----DVALLRTADGALSLPLGKVAPIRLPTVGEAI 154
            :.:.:.    .|..|:.::....: |.::     |||::...:             ||.      
  Fly   109 NQLDSH----DPPNALIRNIIVSK-DWHWPGTFMDVAVIELTN-------------RLR------ 149

  Fly   155 SESMPAVVSGWGHMST-----SNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAA--- 211
                       |:.:.     :||:  |..||.:|::.......|.......|...|.|.:|   
  Fly   150 -----------GNRNNYVTLCTNPL--SSYKSLSVVSYGAGPAENVRTEEIEVLNRMICDSAYGN 201

  Fly   212 ---RNTDACQGD----------SGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
               |.|.||..:          :|.|::|...|.|||:|...|.....||::|.:..  ::|:|
  Fly   202 FLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWSPACKRSNLPGIFTDIHQ--VKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 57/257 (22%)
Tryp_SPc 37..263 CDD:238113 58/259 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 53/248 (21%)
Tryp_SPc 53..256 CDD:304450 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.