DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:116/277 - (41%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQP---------DSRIVNGREATEGQFPYQLSL--RRQTVHICGASILSSN 70
            |.:..|:.|....|.|.         ..||.||..|.||:.||.:.|  .......||.||:.:.
  Fly     7 LALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNT 71

  Fly    71 WAITAAHCIDGHEQQPREFTLRQGSIMRT---------SGGTVQPVKAIYKHPAYDRADMNFDVA 126
            |.:|||||.:|    ....|:..|:.:||         ||..:|       |..|:..:::.|::
  Fly    72 WVLTAAHCTNG----ASGVTINYGASIRTQPQYTHWVGSGDIIQ-------HHHYNSGNLHNDIS 125

  Fly   127 LLRTADGALSLPLGKVAPIRLPTVGEAISE--SMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQ 189
            |:||........:.||   .||:..:...:  ...||.||||.....:| |...|:|..|..::|
  Fly   126 LIRTPHVDFWSLVNKV---ELPSYNDRYQDYAGWWAVASGWGGTYDGSP-LPDWLQSVDVQIISQ 186

  Fly   190 EKCHNDLRHHGGVTEAMFCAAARNTD----ACQGDSGGPISAQ--GTLIGIVSWG--VGCADPYY 246
            ..|......|    :.|.|.   |||    .|.||||||:...  ..|:|:.|:|  .||... .
  Fly   187 SDCSRTWSLH----DNMICI---NTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSG-A 243

  Fly   247 PGVYTRLAHPTIRRWIR 263
            |.|::|:.  ....|||
  Fly   244 PAVFSRVT--GYLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 73/246 (30%)
Tryp_SPc 37..263 CDD:238113 73/246 (30%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.