DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and intr

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:96/266 - (36%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPRQPDSRIVNGREATEGQFP-----YQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPRE 88
            :|.:.::.:.:|:..||.  |     :.:.:..:...||..:::|:...:|:|.|.      || 
  Fly    77 IPAEIETLLTDGQATTEA--PKAVKHFVMRILYENKVICSGALISTRLVLTSALCF------PR- 132

  Fly    89 FTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTA---DGALSLPLGKVAPIRLPTV 150
             |||            ||....||..| .|:.: :.||.|.|.   |.||.|   ..||:..|.|
  Fly   133 -TLR------------QPPPRSYKLQA-SRSRI-YSVANLITGAIEDMALLL---LHAPLEDPFV 179

  Fly   151 GEAISESMPAVVSGWGHMSTSNPV--LSSVLKSTTVLTVNQEKCHNDLR---------------- 197
                                 :|:  ..|.|:....:|:...:.|  ||                
  Fly   180 ---------------------HPIDLCESPLRRNDNVTMYMSQQH--LRFLRTKLIPNSNCKRSY 221

  Fly   198 ---HHGGVTEAMFCAAARN--TDACQGDSGGPISAQGTLIGIVSWGVGCAD-----PYYPGVY-- 250
               .:..:|:.|.||...|  .| ||...|..:..|..|.|:..:|..|:|     ..|..|:  
  Fly   222 AQDENAFITQTMLCALNSNRLVD-CQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKA 285

  Fly   251 -TRLAH 255
             |.|.|
  Fly   286 RTELMH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 60/259 (23%)
Tryp_SPc 37..263 CDD:238113 60/258 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 53/220 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.