DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG34129

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:106/246 - (43%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTS 100
            ||:||    :|.|            .|||:..:....||:|:||     .|...:|...::..|:
  Fly    58 RILNG----DGNF------------ACGAAYYAPLLVITSANCI-----YPYRNSLEGATVEGTA 101

  Fly   101 GG-----------TVQ-PVKAIYKHPAYDRADMNFDVALLRTADGALSLPL-GKVAP-IRLPTVG 151
            ..           |:| |.|.||:       .:..|||::|..|     |: |::.. |||.:| 
  Fly   102 FSECDRENYADIDTIQFPEKFIYQ-------KLYMDVAVVRLRD-----PVRGRLTEFIRLCSV- 153

  Fly   152 EAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNTDA 216
             .:...|..||.|||..:|...:.||..::.||..::.::|....:.....:.::.....:|...
  Fly   154 -KVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQ 217

  Fly   217 CQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTK 267
            |..|.|.|:.....|.|:||:|..|.|...||:||     .|||..|.:|:
  Fly   218 CLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYT-----NIRRVKRFITE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 65/239 (27%)
Tryp_SPc 37..263 CDD:238113 64/239 (27%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 66/242 (27%)
Tryp_SPc 55..261 CDD:304450 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.