DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG15498

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:37/98 - (37%) Gaps:28/98 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IYKHPAYDRADMNFDVALLRTADGALSLPLGKVA------PIRLPT------------------V 150
            ::..|......:..:.|...|.:|.::||||.|:      ..|:||                  .
  Fly   157 VFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSARVPTSHTHFFCAHKDPDLRFESE 221

  Fly   151 GEAISESMPAVVSGWGHMSTS-NPVLSSVLKST 182
            |:.|....|.|:.   |..|: |..:.:||.:|
  Fly   222 GKTIPVHNPLVIV---HAVTNRNLAVENVLANT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 22/98 (22%)
Tryp_SPc 37..263 CDD:238113 22/98 (22%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.