DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG31266

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:119/273 - (43%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PIPFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRR-QTVHICGASILSSN 70
            |:|.      |..:|..|:..|||:   .|::.|..|.||.:|:..|::. .:.|:|||.||...
  Fly    31 PLPG------LANIERHRSTEAVPQ---GRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDET 86

  Fly    71 WAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQ---------PVKAIYKHPAYDRADMNFDVA 126
            |.:|||.|:.|         ||..:::..: |||.         .|..|:.|..:|:...:.|:|
  Fly    87 WVLTAASCVAG---------LRPLNLLVVT-GTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIA 141

  Fly   127 LLRTADGALSLPLGKVAP-IRLPTVGEAISESMPAVVSGWGH---MSTSNPVLSSVLKSTTVLTV 187
            ||:.:.   .:....|.. |.|..:.| :.|......:|||.   |.|....|...  |.|.|.|
  Fly   142 LLQLSS---KIEFNDVTKNITLADIDE-LEEGDKLTFAGWGSSEAMGTYGRYLQEA--SGTYLPV 200

  Fly   188 NQEKCHNDLRHHGGVTEAMFCAAA-RNTDACQGDSGGP-ISAQGTLIGIVSWGVGCADPYYPGVY 250
              :.|...|::...|.....|... ....||.||:||| |..|..|:||.:|||.|... ||.||
  Fly   201 --DACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGRG-YPDVY 262

  Fly   251 TRLAHPTIRRWIR 263
            .|.|.  ...|||
  Fly   263 ARTAF--YHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 73/241 (30%)
Tryp_SPc 37..263 CDD:238113 73/241 (30%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 73/241 (30%)
Tryp_SPc 52..275 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.