DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG12951

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:87/273 - (31%)
Similarity:131/273 - (47%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRR-QTVHICGASILSSNWAITA 75
            |...::|||..:....|.|  ..||:|||.:::..::|:.:|||. ...|.||.||:|.::.:||
  Fly     7 LSLSLIVILAVTTVGQAAP--SISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTA 69

  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTS--GGTVQPVKAIYKHPAYDRADMNF-DVALLRTA-----D 132
            |||.:|   :|.:....|..:...|  |..|..:|.|.:|..:|....|. |::||...     |
  Fly    70 AHCTNG---RPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD 131

  Fly   133 GALSLPLGKVAPIRLPTVGEAISES---MPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKC-- 192
            |.      .|||:.||.:..|:.:|   :..|:.|||...|...| ...|:..::...:.|:|  
  Fly   132 GV------SVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSV-QDTLQEVSLKIYSDEECTS 189

  Fly   193 -HN---DLRHH--GGVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGV-GCADPYYPGVY 250
             ||   |.::|  |||.|.       ....|.||||||:...|..:|||||.: .|....|||||
  Fly   190 RHNGQTDPKYHICGGVDEG-------GKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVY 247

  Fly   251 TRLAHPTIRRWIR 263
            .:::...  .||:
  Fly   248 CKVSQYV--DWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 78/246 (32%)
Tryp_SPc 37..263 CDD:238113 78/246 (32%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 78/246 (32%)
Tryp_SPc 30..260 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.