DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:245 Identity:86/245 - (35%)
Similarity:134/245 - (54%) Gaps:24/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTS 100
            ::..|::|.||::|:|.||::..||.|||:::|::|.||||||. .....|:::.:..|.:: :.
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF-VRSANPKDWKVSFGFLL-SK 248

  Fly   101 GGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESMP---AVV 162
            ....:.||:|..|..|.....|.|:|::|     ||.|:.....||...:.||..:..|   .||
  Rat   249 PQAQRAVKSIVIHENYSYPAHNNDIAVVR-----LSSPVLYENNIRRACLPEATQKFPPNSDVVV 308

  Fly   163 SGWGHMST--SNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGG 223
            :|||.:.:  .:|   ::|:...|..::.:.|::...:.|.:|..|.||.  ....|||||||||
  Rat   309 TGWGTLKSDGDSP---NILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQGDSGG 370

  Fly   224 PISAQGT-----LIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTKL 268
            |:.::.:     |.||||||..||.|..||||||:.|  .|.||...|.|
  Rat   371 PLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTH--YRDWISSKTGL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/237 (35%)
Tryp_SPc 37..263 CDD:238113 83/237 (35%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 82/237 (35%)
Tryp_SPc 187..415 CDD:238113 84/239 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.