DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG32374

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:239 Identity:85/239 - (35%)
Similarity:124/239 - (51%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRT 99
            :|||||::....:.|||.:|......|||..||:..|.:||.||..|:   |..:|:|.||..:.
  Fly    72 TRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGN---PGRYTVRAGSTQQR 133

  Fly   100 SGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL--GK-VAPIRLPTVGEAISESMPA- 160
            .||.::.|:....||.|....|..|:.:::     |..||  |: |..::||:..   ::..|. 
  Fly   134 RGGQLRHVQKTVCHPNYSEYTMKNDLCMMK-----LKTPLNVGRCVQKVKLPSTR---TKRFPKC 190

  Fly   161 -VVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG-GVTEAMFCAAARNTDACQGDSGG 223
             :.||||..|.:...:...|:...|..|::.||..|.|..| .:.:.|.||..:|.|.|.|||||
  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGG 255

  Fly   224 PISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTK 267
            |:...|.|.||.|:|:|||...|||||..:...|  |||:.:.|
  Fly   256 PLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYT--RWIKKVAK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/231 (35%)
Tryp_SPc 37..263 CDD:238113 82/231 (35%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 82/231 (35%)
Tryp_SPc 74..295 CDD:238113 83/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.