DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG16998

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:138/257 - (53%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVH---ICGASILSSNWAI 73
            ::|.||:::...:|.|..|::   |||.|.|......|:..|:   |||   .|.:::::|.|.:
  Fly     3 ILALILLLICGHKTSALSPQE---RIVGGVEVPIHLTPWLASI---TVHGNYSCSSALITSLWLV 61

  Fly    74 TAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLP 138
            ||.||:    |.|..:::|.||.....||..:.|.::..||.::...:..|:|||: .|.:.:|.
  Fly    62 TAGHCV----QYPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLK-LDKSFTLG 121

  Fly   139 LGKVAPIRLPTVGEAISESMP--AVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRH-HG 200
             |.:..::||.....|   :|  .:|:|||:...::......|:.|.|..:||..|.....| |.
  Fly   122 -GNIQVVKLPLPSLNI---LPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHR 182

  Fly   201 GVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            .:|:.|.|||....|.|.||||.|:..:|:..||||:..|||||::||||||||:..  .||
  Fly   183 PITDDMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYV--TWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/231 (35%)
Tryp_SPc 37..263 CDD:238113 81/232 (35%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 80/231 (35%)
Tryp_SPc 25..242 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.