DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG32277

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:133/272 - (48%) Gaps:37/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ::|:.|:.::.:...:.....||  .:|..|:........:.::|||.....||..|:|.|..:|
  Fly     2 YILLIGLALLHQLEGSSLFTLRQ--GKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLT 64

  Fly    75 AAHCIDGHEQQPREFTLRQGSIMRTSGGTVQP--VKAIY---KHPAY-DRADMNFDVALLRTADG 133
            ||||::|..||.|:.|:.  :..:..|..:.|  |::.:   ..|.| .:..::.|:|::|    
  Fly    65 AAHCLEGRYQQVRDLTVH--AQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIR---- 123

  Fly   134 ALSLPL---GKVAPIRLPTVGEAISESMP----AVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEK 191
             ||.|.   |..:.:::.      ...:|    ..|.|||.::......:..|:...|..::..:
  Fly   124 -LSRPFDIAGNASLVKID------YNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRE 181

  Fly   192 CHNDLRHHGG----VTEAMFCAAARNT-DACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYT 251
            |   ::..|.    ||..||||..:|. ||||||||||....|..:||||||.||... ||||||
  Fly   182 C---IKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVSWGYGCGSG-YPGVYT 242

  Fly   252 RLAHPTIRRWIR 263
            ||:.|:|..|::
  Fly   243 RLSSPSITYWLK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 77/243 (32%)
Tryp_SPc 37..263 CDD:238113 78/243 (32%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 75/236 (32%)
Tryp_SPc 27..246 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.