DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG32833

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:288 Identity:66/288 - (22%)
Similarity:107/288 - (37%) Gaps:53/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPFLLIAGILVILEASRTEAAVPRQPDSR------IVNGREATEGQFPYQLSLRRQTVHICGASI 66
            :|..|   .|.:|..|.|.|....:.|..      .:.|........|:..|:..:....|..:|
  Fly     6 LPIFL---ALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAKCDGAI 67

  Fly    67 LSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTA 131
            ...:..:||..|:||...  :...:|.||..|:.|.....|..|..|..:....:..:||:|:..
  Fly    68 YKLSHIVTAGKCVDGFLN--KVIRVRVGSTTRSDGVIEVAVCNITVHEKFTGQTVFHNVAILKLC 130

  Fly   132 DGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVL--------------SSVL 179
            :     ||   ..:.||:|  ..:..|.......:||       |..              :..|
  Fly   131 E-----PLEASKTIQPIQL--ANQLPSNGAKVTANGW-------PSFRWWAMYWKKCLDDEAYKL 181

  Fly   180 KSTTVLTVNQEKCHNDL--RHH---GGVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGV 239
            :...|..:...:| .||  |::   ...|:.:||......:||....|.|:...|.|:||::.| 
  Fly   182 QKAEVKLLGPSQC-TDLWARNNWSKKNFTDDLFCTEKFAKEACSLAMGSPVVHNGKLVGIITKG- 244

  Fly   240 GCADPYYPGVYTRLAHPTIRRWIRLLTK 267
            ||::  ||.||..|.  ..:.|:...||
  Fly   245 GCSE--YPEVYINLI--KYKDWLHNHTK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 55/253 (22%)
Tryp_SPc 37..263 CDD:238113 56/247 (23%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 56/247 (23%)
Tryp_SPc 40..262 CDD:214473 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.