DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Ser8

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:264 Identity:100/264 - (37%)
Similarity:140/264 - (53%) Gaps:25/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVP--RQPDS-----RIVNGREATEGQFPYQLSLRRQTVHICGASILS 68
            ||||..|.:| |....|.:|  .:|.:     |||.|..::....|:|:||:|...|.||.||:|
  Fly     3 LLIATFLALL-ALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIIS 66

  Fly    69 SNWAITAAHCIDGHEQQP---REFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRT 130
            :|..:|||||:|    .|   ....:|.||..||.||.:..|.||..|.||:......|:.::| 
  Fly    67 NNIIVTAAHCLD----TPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVR- 126

  Fly   131 ADGALSLPLGKVAPIRLPTVGEAI-SESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHN 194
                |...|...:.|:..|:..|. :....|.:||||..||..|..:::|...|.: |.:.:|.:
  Fly   127 ----LKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRI-VGRSQCGS 186

  Fly   195 DLRHHGGVTEA-MFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTI 258
            ....:|...:| |.||||.|.||||||||||:.:.|.|:|:||||..||...|||||..:|.  :
  Fly   187 STYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAE--L 249

  Fly   259 RRWI 262
            |.|:
  Fly   250 RDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 89/230 (39%)
Tryp_SPc 37..263 CDD:238113 89/231 (39%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 89/230 (39%)
Tryp_SPc 35..253 CDD:238113 88/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.