DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss3

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:269 Identity:90/269 - (33%)
Similarity:127/269 - (47%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ||.:.|:.|         |.|...|.:||.|....|...|||:|| ....|.||.|:::..|.::
  Rat     6 FLALVGVAV---------AFPVDDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVS 60

  Fly    75 AAHCIDGHEQQPREFTLRQGS-IMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALS 136
            ||||.....|      :|.|. .:....|..|.|.|  |.|||.::..::|.|:.|::     ||
  Rat    61 AAHCYKTRIQ------VRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLNNDIMLIK-----LS 114

  Fly   137 LPL---GKVAPIRLPTVGEAISESMPA----VVSGWGH---MSTSNPVLSSVLKSTTVLTVNQEK 191
            .|:   .:||.:.||      |...||    ::||||:   :..:||.|...|.:.   .:.|..
  Rat   115 SPVKLNARVATVALP------SSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAP---VLPQAD 170

  Fly   192 CHNDLRHHGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLA 254
            |  :..:.|.:|..|.|..  ....|:||||||||:...|.|.||||||.|||....|||||::.
  Rat   171 C--EASYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVC 233

  Fly   255 HPTIRRWIR 263
            :..  .||:
  Rat   234 NYV--DWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 81/240 (34%)
Tryp_SPc 37..263 CDD:238113 82/240 (34%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 81/240 (34%)
Tryp_SPc 24..242 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.