DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and gammaTry

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:97/257 - (37%)
Similarity:136/257 - (52%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            :|::.:...|..:..|..:| |.|.|||.|...|...||:|:||:|...|.||.||.|||..:||
  Fly     6 ILLSAVACALGGTVPEGLLP-QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69

  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLG 140
            |||:........:  :|.||...:|||....|.:...|..|:...|..|:|::: .:|||:.. .
  Fly    70 AHCLQSVSASVLQ--IRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIK-INGALTFS-S 130

  Fly   141 KVAPIRL----PTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGG 201
            .:..|.|    |..|.|.|      |||||.:|..:..:.|.|:...|..|:|.:|.:....:|.
  Fly   131 TIKAIGLASSNPANGAAAS------VSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189

  Fly   202 -VTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
             :...|.||||...||||||||||:.:.|.|:|:||||.|||...|||||..:|  .:|.|:
  Fly   190 QIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA--ALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 90/230 (39%)
Tryp_SPc 37..263 CDD:238113 90/231 (39%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 90/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443342
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.