DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and thetaTry

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:245 Identity:84/245 - (34%)
Similarity:130/245 - (53%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PRQPDSRIVNGREATEGQFPYQLSLRRQT-VHICGASILSSNWAITAAHCIDGHEQQPREFTLRQ 93
            |.:.:.|||.|.:.|.|..|||:||:.:: .|.||.|:::.:..:|||||:.|  ::..:..:|.
  Fly    28 PFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVG--RKVSKVFVRL 90

  Fly    94 GSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESM 158
            ||.:...||.|..|:.:..:..|:...|.:||.:|:..:        ||.........|..:|:.
  Fly    91 GSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDE--------KVKETENIRYIELATETP 147

  Fly   159 P----AVVSGWGH------MSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVT-EAMFCAAAR 212
            |    |||:|||.      |:     |...|:...|..|:.:.|.:|...:|.:. ::|.||..:
  Fly   148 PTGTTAVVTGWGSKCYFWCMT-----LPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEK 207

  Fly   213 NTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            ..||||||||||::...||:||||||..||....||||:.:  |.:|:||
  Fly   208 KKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDV--PALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 81/237 (34%)
Tryp_SPc 37..263 CDD:238113 82/238 (34%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 81/237 (34%)
Tryp_SPc 35..255 CDD:238113 80/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.