DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and etaTry

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:268 Identity:90/268 - (33%)
Similarity:127/268 - (47%) Gaps:35/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQT------VHICGASILSS 69
            |.|..:|.:|..    .||..|.|.|||.|.:.:.....|.:.|||::      ...||..||.:
  Fly     6 LRILAVLFLLGI----YAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDA 66

  Fly    70 NWAITAAHCIDGHEQQPREFTLRQGSIMRTS-GGTVQPVKAIYKHPAYDRADMNFDVALLRTADG 133
            ....|||||:  :.::...|.:..|...|.. .|.|..|..:..|..|:.:.|:.|:||: ..|.
  Fly    67 VTIATAAHCV--YNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALV-VVDP 128

  Fly   134 ALSLPLGKVAPIRL-------PTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEK 191
              .|||...:.:..       |.||      :.|.:||||: :..|.:.|..|:...|..|:.||
  Fly   129 --PLPLDSFSTMEAIEIASEQPAVG------VQATISGWGY-TKENGLSSDQLQQVKVPIVDSEK 184

  Fly   192 CHNDLRHHGGVTEAMFCA--AARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLA 254
            | .:..:...::|.|.||  :....||||||||||:.....|.||||||.|||.|.|||||..:|
  Fly   185 C-QEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVA 248

  Fly   255 HPTIRRWI 262
            :  .:.||
  Fly   249 Y--YKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/241 (33%)
Tryp_SPc 37..263 CDD:238113 81/242 (33%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/241 (33%)
Tryp_SPc 28..257 CDD:238113 81/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.