DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and PRSS41

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:260 Identity:81/260 - (31%)
Similarity:120/260 - (46%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREF 89
            :||...|:..:.:..|.|:..|::|:|.|||.:..|.||.|:||..|.::||||...| ..|.|:
Human    59 SEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKH-YYPSEW 122

  Fly    90 TLRQGSIMRTSGGTVQPVKAIYKHPAYDRAD----------MNFDVALLRTADGALSLPLGKVAP 144
            |::.|.:  ||..|...::|....  |...|          :..|:||||.|.....  ...:.|
Human   123 TVQLGEL--TSRPTPWNLRAYSSR--YKVQDIIVNPDALGVLRNDIALLRLASSVTY--NAYIQP 181

  Fly   145 IRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSV--LKSTTVLTVNQEKCH---NDLRHHGGVTE 204
            |.:.:............|:|||.:|.|...|...  |:...|..:|..:|:   ........:.:
Human   182 ICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWD 246

  Fly   205 AMFCAAAR--NTDACQGDSGGPISAQGT----LIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            :||||.|.  :.|.|:||||||:.....    .:||||||:.|..|..|||||.::  ....|||
Human   247 SMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNIS--VYFHWIR 309

  Fly   264  263
            Human   310  309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 75/246 (30%)
Tryp_SPc 37..263 CDD:238113 76/246 (31%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.