DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss21

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:308 Identity:94/308 - (30%)
Similarity:144/308 - (46%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPFL-LIAGILVILE--ASRTEAAVPRQPD-----------------SRIVNGREATEGQFPYQL 52
            :|.| ::..:.|.|:  :|..:...|.:|:                 ||||.|.||..|::|:|.
  Rat     9 VPLLVVVVAVEVTLQSTSSHVKPVDPEKPELQEANLLSGPCGHRTIPSRIVGGEEAELGRWPWQG 73

  Fly    53 SLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSI-MRTSGGTVQ------PVKAI 110
            |||....|:|||::|:..|.:|||||.. .:..|.::|::.|.: .|.|...:|      .::.|
  Rat    74 SLRVWGNHLCGATLLNRRWVLTAAHCFQ-KDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDI 137

  Fly   111 YKHPAYDRADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSN 172
            :..|.|.. ....|:|||:     ||.|:   ..:.||.|.......:......|:|||.:....
  Rat   138 FLSPKYTE-QFPHDIALLK-----LSSPVTYSNFIQPICLLNSTYKFANRTDCWVTGWGAIGEDE 196

  Fly   173 PV-LSSVLKSTTVLTVNQEKCHN-----DLRHHGGVTEAMFCAAA--RNTDAC---------QGD 220
            .: |.:.|:...|..:|...|::     |.|.:  :...|.||.:  ...|||         |||
  Rat   197 SLPLPNNLQEVQVAIINNTMCNHLFKKPDFRIN--IWGDMVCAGSPEGGKDACFAKLTYAAPQGD 259

  Fly   221 SGGP-ISAQGTL---IGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRL 264
            |||| :..|.|:   :|:||||:||..|..|||||.::|.  ..||||
  Rat   260 SGGPLVCNQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHH--YNWIRL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/256 (32%)
Tryp_SPc 37..263 CDD:238113 82/256 (32%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 82/256 (32%)
Tryp_SPc 58..304 CDD:238113 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.