DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Send2

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:270 Identity:86/270 - (31%)
Similarity:126/270 - (46%) Gaps:63/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            :.|...|::|..:...|....:|:.||:.|:.....:.|:|:|::|...|:||.||.|::..|||
  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65

  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL- 139
            |||:.|...|     :|.||.::.|.|:|..|.||..|..     :..|:|::|     ||.|| 
  Fly    66 AHCVQGQGYQ-----VRAGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVR-----LSKPLE 115

  Fly   140 --GKVAPIRL----PTVGEAISESMPAVVSGWGHMS-TSNPVLSSVLKSTTVLTVNQEKCHNDLR 197
              .:|.||.|    |..|..      |.|||||..| .|:|:                    ||:
  Fly   116 FTNQVQPIPLAKTNPPPGSI------AFVSGWGSSSYYSHPI--------------------DLQ 154

  Fly   198 ---------HHGGVTE-AMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTR 252
                     ::.|:|| :..||.:....||:||||||:.....|:|:||.|.  .|..|..:||.
  Fly   155 GVNLYIQWPYYCGLTEPSRICAGSFGRAACKGDSGGPLVFDQQLVGVVSGGT--KDCTYSSIYTS 217

  Fly   253 LAHPTIRRWI 262
            :  |..|.||
  Fly   218 V--PYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/243 (33%)
Tryp_SPc 37..263 CDD:238113 80/244 (33%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 79/243 (33%)
Tryp_SPc 27..225 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.