DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG31954

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:267 Identity:98/267 - (36%)
Similarity:142/267 - (53%) Gaps:23/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVI---LEASRTEAAVPRQP-------DSRIVNGREATEGQFPYQLSLRRQTVHICGAS 65
            |::||:.:|   ::..|:...|.:.|       |.|||.|........|:|:||:..: ||||.|
  Fly    15 LVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTSS-HICGGS 78

  Fly    66 ILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRT 130
            |:|..|.:|||||..|  :......:|.|:......|.:..|:.|.:|..::..::::|.:||:.
  Fly    79 IISEEWILTAAHCTYG--KTADRLKVRLGTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQL 141

  Fly   131 ADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLS-SVLKSTTVLTVNQEKCHN 194
            |. .:.....|.| ::||.......:.....|||||  :|.|.:.| ..|:...|..||||.|..
  Fly   142 AH-PIKFDETKKA-VKLPESQMKYMDGEACFVSGWG--NTQNLLESREWLRQVEVPLVNQELCSE 202

  Fly   195 DLRHHGGVTEAMFCAA--ARNTDACQGDSGGP-ISAQGTLIGIVSWGVGCADPYYPGVYTRLAHP 256
            ..:.:|||||.|.||.  ....|||||||||| :|..|.|:|:||||.|||.|.|||||:|::. 
  Fly   203 KYKQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSF- 266

  Fly   257 TIRRWIR 263
             .|.||:
  Fly   267 -ARDWIK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 88/229 (38%)
Tryp_SPc 37..263 CDD:238113 88/229 (38%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 88/229 (38%)
Tryp_SPc 51..274 CDD:238113 89/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.