DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and prss60.3

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:263 Identity:88/263 - (33%)
Similarity:129/263 - (49%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILEASRTEAAVPRQP--DSRIVNGREATEGQFPYQLSLR--RQTVHICGASILSSNWAITAA 76
            :|:.::.|.::..|..|.  ::|||.|..|:.|.:|:|:||.  :...|.||.|::||.|.:|||
Zfish    13 LLICVKGSLSQLNVCGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAA 77

  Fly    77 HCIDGHEQQPREFTLRQGSIMRTSGG-----TVQPVKAIYKHPAYDRADMNFDVALLRTADGALS 136
            ||:.|    ..|.||......||..|     |.:.|...:.|.:|:....:.|:||||.:.....
Zfish    78 HCLSG----VSETTLVVYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTF 138

  Fly   137 LPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTS-NPVLSSVLKSTTVLTVNQEKCHNDLRHHG 200
              ...:.|:.|.......|....:.::|||.:... |.....:|:.|.:..|..::| |.|...|
Zfish   139 --TNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-NALLGSG 200

  Fly   201 GVTEAMFCAAAR--NTDACQGDSGGPISAQGTLI----GIVSWGVGCADPYYPGVYTRLAHPTIR 259
            .||..|.||...  ..|.||||||||:..:...:    ||.|||.|||||..||||||::.  .:
Zfish   201 TVTNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQ--YQ 263

  Fly   260 RWI 262
            .||
Zfish   264 SWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/239 (34%)
Tryp_SPc 37..263 CDD:238113 83/240 (35%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 83/240 (35%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.