DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG4271

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:253 Identity:68/253 - (26%)
Similarity:109/253 - (43%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            :||....|::..:|:        .:.|.||.||....:.:..|:.....|.||.:::.|...:||
  Fly     1 MLIGSCWVLILFARS--------SNGIYNGVEAKFDFWTFLASVWVSGYHECGGAVIDSRIVLTA 57

  Fly    76 AHCIDGHEQQP-REFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL 139
            |.|:   :.:| :..|:|.|:.....||.:..|.|:..|..|...|.  |:|||     .|..|:
  Fly    58 AQCV---KNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYKNWDN--DIALL-----WLEKPV 112

  Fly   140 GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTE 204
            ..|...::|...:..||:.....:|||.....:.|::..|::.......:..|..:|....|  |
  Fly   113 LSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVG--E 175

  Fly   205 AMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            .:.||.....|.|.||.|||:.....::||...|.||.....|.:||.:.|  ...||
  Fly   176 ELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFH--YLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 62/226 (27%)
Tryp_SPc 37..263 CDD:238113 64/227 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 64/227 (28%)
Tryp_SPc 19..231 CDD:214473 62/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.