DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG11911

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:120/266 - (45%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LIAGILVILEASRTEAA---------VPRQPDSRIVNGREATEGQFPYQLSLRRQTV---HICGA 64
            ||...|||...:..:.|         ||......::||.||.....||.:||....:   ||||.
  Fly     3 LITVTLVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGG 67

  Fly    65 SILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAI---YKHPAYDRADMNFDVA 126
            ::::.:|.:||||||    .:|...::..|...|.....:...:.:   ..|..|......:|:|
  Fly    68 TLINKDWIVTAAHCI----SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIA 128

  Fly   127 LLRTADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEK 191
            ||...:..:....  |.|..||: .|.:.|. ...:.|||...:.....:..|::.|...:|.|:
  Fly   129 LLHVNESFIFNEW--VQPATLPS-REQVHEG-ETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEE 189

  Fly   192 CHNDLRHHGGVTEAMFCAAA--RNTDACQGDSGGPI-----SAQGTLIGIVSWG-VGCADPYYPG 248
            |..:|.....:.|:..|:::  ::..||.||||||:     :|...|||||||| :.|.....|.
  Fly   190 CKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPS 254

  Fly   249 VYTRLA 254
            :||:::
  Fly   255 IYTKVS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 66/233 (28%)
Tryp_SPc 37..263 CDD:238113 66/232 (28%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 66/232 (28%)
Tryp_SPc 37..266 CDD:214473 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.