DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG1304

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:282 Identity:91/282 - (32%)
Similarity:129/282 - (45%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKCRAPI---PFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHIC 62
            |:..:|.|   .|||:..:.|        .:.|...:.|:|.|.:|.:.|||:|:|||....|.|
  Fly     1 MRSVKAAILLGSFLLLLAVPV--------HSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSC 57

  Fly    63 GASILSSNWAITAAHCIDGHEQQ-------PREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRAD 120
            |.||||.|:.:|||||:...:..       ...||:|.||..|.|||.:..|..:..|..|.   
  Fly    58 GGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--- 119

  Fly   121 MNF--DVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPA----VVSGWGHMSTSNPVLS 176
             ||  ||||||     |..||   ..:.||.|||.      ..||    ::||||.:..... |.
  Fly   120 -NFLNDVALLR-----LESPLILSASIQPIDLPTA------DTPADVDVIISGWGRIKHQGD-LP 171

  Fly   177 SVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGC 241
            ..|:..|:.:::.|:| ::|...|..:|......|.| .||.||||||......::|:..:....
  Fly   172 RYLQYNTLKSISLERC-DELIGWGVQSELCLIHEADN-GACNGDSGGPAVYNNQVVGVAGFVWSA 234

  Fly   242 ADPYYPGVYTRLAHPTIRRWIR 263
            ....||..|.|:.:.  ..||:
  Fly   235 CGTSYPDGYARVYYH--NEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 81/241 (34%)
Tryp_SPc 37..263 CDD:238113 81/241 (34%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 81/241 (34%)
Tryp_SPc 32..256 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.