DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Ser6

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:271 Identity:92/271 - (33%)
Similarity:129/271 - (47%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            :|:...|:.|......|  |.:.:.|:|.|.:|.:.|||:|:|||....|.||.|||:..:.:||
  Fly     8 ILLCSFLLFLVLPVQSA--PGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTA 70

  Fly    76 AHCID----GHEQQP---REFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNF--DVALLRTA 131
            |||:.    .|...|   ..||:|.||..|.|||.:..|..:..|..|.    ||  ||||||  
  Fly    71 AHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG----NFLNDVALLR-- 129

  Fly   132 DGALSLPL---GKVAPIRLPTVGEAISESMPA----VVSGWGHMSTSNPVLSSVLKSTTVLTVNQ 189
               |..||   ..:.||.||||      ..||    |:||||.:..... |...|:..|:.::.:
  Fly   130 ---LESPLILSASIQPIDLPTV------DTPADVDVVISGWGRIKHQGD-LPRYLQYNTLKSITR 184

  Fly   190 EKCHNDLRHHGGVTEAMFCAAAR-NTDACQGDSGGPISAQGTLIGIVSWGV-GCADPYYPGVYTR 252
            ::| .:|...|  .|...|...: :..||.||||||......|:|:..:.| ||... ||..|.|
  Fly   185 QQC-EELIDFG--FEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYAR 245

  Fly   253 LAHPTIRRWIR 263
            :.:  .:.||:
  Fly   246 VFY--FKDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 85/243 (35%)
Tryp_SPc 37..263 CDD:238113 85/243 (35%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 85/243 (35%)
Tryp_SPc 32..256 CDD:238113 86/245 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.