DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss53

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:282 Identity:77/282 - (27%)
Similarity:124/282 - (43%) Gaps:46/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFLLIAGILVILEASRTEAAV-----PRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILS 68
            |.|||.|.:|::|..:.....     |..|:.:..|   ...|::|:|.|:|||.||||..|:::
Mouse     7 PELLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGN---TLPGEWPWQASVRRQGVHICSGSLVA 68

  Fly    69 SNWAITAAHCIDG-HEQQPREFTLRQGSIM---RTSGGTVQPVKAIYKHPAYDRADMNFDVALLR 129
            ..|.:|||||.:. ...:...:::..||:.   ::.|.....|.|:....||:......|:|||:
Mouse    69 DTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQ 133

  Fly   130 ----TADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQE 190
                |....|.||        .||.......|..|  :|| ..:||:  :|..|::..:..:::.
Mouse   134 LTHPTVQTTLCLP--------QPTYHFPFGASCWA--TGW-DQNTSD--VSRTLRNLRLRLISRP 185

  Fly   191 KC---HNDLRHH---GGVTEAMFCAAAR--NTDACQGDSGGPI-----SAQGTLIGIVSWGVGCA 242
            .|   :|.|...   ......|.|..|:  ....||||||||:     ......:||:|:...||
Mouse   186 TCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCA 250

  Fly   243 DPYYPGVYTRLA-HPTIRRWIR 263
            ....|.:.|.:| |.:   |::
Mouse   251 QEDTPVLLTDMAVHSS---WLQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 67/247 (27%)
Tryp_SPc 37..263 CDD:238113 68/247 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 3/21 (14%)
Tryp_SPc 45..271 CDD:238113 67/241 (28%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.