DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss34

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:248 Identity:73/248 - (29%)
Similarity:112/248 - (45%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVNGREATEGQFPYQLSLRRQTV------HICGASILSSNWAITAAHCIDGHEQQPREFTLRQGS 95
            ||.|...:..:||:|:|||...:      |.||.|::...|.:|||||:...|.:.....::.|.
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly    96 IMRTSGGTVQPVKAIYKHPAYDR---ADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISES 157
            :.......:..|..|.:||.:..   |....|:|||: .|..:.|. ..|.|:.||.....||..
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLK-LDTRVVLS-EHVYPVSLPAASLRISSK 162

  Fly   158 MPAVVSGWGHMSTSNPVLSSV-LKSTTVLTVNQEKCHNDLRHHGG-------VTEAMFCAAARNT 214
            ....|:|||.:....|:.... |:...|..|....|....:.:..       :.:.|.||.....
Mouse   163 KTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCAGKEGR 227

  Fly   215 DACQGDSGGPI----SAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            |:|:.|||||:    :.....:|:||||:||..|.:||||||:.  :...||:
Mouse   228 DSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVM--SYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/245 (29%)
Tryp_SPc 37..263 CDD:238113 72/246 (29%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 72/246 (29%)
Tryp_SPc 35..277 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.