DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG9672

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:249 Identity:70/249 - (28%)
Similarity:102/249 - (40%) Gaps:67/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCI-- 79
            |:::.|...||    ||..||..|.:|..||.|||.:|.....:.|||.|:...:|:||..|:  
  Fly     9 LILVAAGVLEA----QPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYALTALSCVCS 69

  Fly    80 DGHEQQPRE--FTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRT------ADGALS 136
            ||.:.....  |.:..||:...:|..:: |:.|..:|.|  :.:...:||||.      ::...:
  Fly    70 DGKDTPWAAVLFAVTVGSVDLYNGKQIR-VEEITINPNY--STLKTGIALLRLQEEITFSETVNA 131

  Fly   137 LPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGG 201
            :||.:    .:|.:|..:.      |||||.              ||...||.   |..|:.  |
  Fly   132 IPLSQ----DVPPMGSQVE------VSGWGR--------------TTESEVNM---HRTLQI--G 167

  Fly   202 VTEAMF---CAAA------------------RNTDACQGDSGGPISAQGTLIGI 234
            ..|.|.   ||.|                  |....|.||.|||...||.|:|:
  Fly   168 AAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 64/230 (28%)
Tryp_SPc 37..263 CDD:238113 63/229 (28%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 64/230 (28%)
Tryp_SPc 25..250 CDD:238113 63/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.