DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and sphe

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:259 Identity:75/259 - (28%)
Similarity:118/259 - (45%) Gaps:21/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAI 73
            |.|:|.|::.:.......|      ..||:.|.:|......:..|||....|:||.||||....:
  Fly     4 PRLVILGLIGLTAVGMCHA------QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKIL 62

  Fly    74 TAAHCI--DGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALS 136
            |.|||:  ||..........|.||..:.:||.:..|:::..||.|  .::|.::|:: |....|:
  Fly    63 TTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVI-TLSSELT 124

  Fly   137 LPLGKVAPIRLPTVGEAI-SESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG 200
            . ..::..|.|...|||: :|....:|:|||.  ||:...|..::..::....:..|.:....| 
  Fly   125 Y-TDRITAIPLVASGEALPAEGSEVIVAGWGR--TSDGTNSYKIRQISLKVAPEATCLDAYSDH- 185

  Fly   201 GVTEAMFCAAAR-NTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
              .|..||.|.. ....|.||.||......||||:.::.||.....||.|:.||:  :...||:
  Fly   186 --DEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLS--SYADWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 68/229 (30%)
Tryp_SPc 37..263 CDD:238113 68/229 (30%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/215 (31%)
Tryp_SPc 42..244 CDD:214473 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.