DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG9676

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:266 Identity:93/266 - (34%)
Similarity:140/266 - (52%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPF------LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASI 66
            :||      |..||:|     ::.::.|    :.|||.|.:|.|||||:|:||||:..|.||.||
  Fly     2 LPFWTSLLVLCAAGVL-----AQNDSVV----EPRIVGGTKAREGQFPHQISLRRRGSHTCGGSI 57

  Fly    67 LSSNWAITAAHCI-DGHEQQP-REFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLR 129
            :|.::.:|||||: .|:...| .|..::.||::.:|||...||..:..||.|:  ....|||:||
  Fly    58 ISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLR 120

  Fly   130 TADGALSLPL-GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCH 193
            ..:   ||.. ..:|.|:|.|  |.........:||||.:|...|:.:|:| ...|..:::|.|.
  Fly   121 LRN---SLTFNSNIAAIKLAT--EDPPNDATVDISGWGAISQRGPISNSLL-YVQVKALSRESCQ 179

  Fly   194 ND-LRHHGGVTEAMFCAA-ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHP 256
            .. ||.   :.|...|.. .::..||.||||||.:.||.|:|:.|:.:|......|..|.|::  
  Fly   180 KTYLRQ---LPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVS-- 239

  Fly   257 TIRRWI 262
            .:|.||
  Fly   240 KLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 84/230 (37%)
Tryp_SPc 37..263 CDD:238113 85/231 (37%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 84/230 (37%)
Tryp_SPc 28..248 CDD:238113 85/231 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.