DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and prss59.1

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:260 Identity:89/260 - (34%)
Similarity:133/260 - (51%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ||::.|....|:            |.:||.|.|......|:|.|| ....|.||.|::|..|.::
Zfish     6 FLVLLGAAFALD------------DDKIVGGYECQPNSQPWQASL-NSGYHFCGGSLVSEYWVVS 57

  Fly    75 AAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPV--KAIYKHPAYDRADMNFDVALLRTADGALSL 137
            ||||.....    |..|.:.:|: .:.||.|.:  :.:.::|.||..|::.|:.|::     ||.
Zfish    58 AAHCYKSRV----EVRLGEHNIV-INEGTEQFITSEKVIRNPNYDSWDLDSDIMLIK-----LSK 112

  Fly   138 P--LGK-VAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHH 199
            |  |.| |.|:.||. |.|...:| ..|||||: :.|:...|:.|:...:..::...|:|.  :.
Zfish   113 PATLNKYVQPVALPN-GCAADGTM-CRVSGWGN-TMSSTADSNKLQCLEIPILSDRDCNNS--YP 172

  Fly   200 GGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            |.:|:.||||.  ....|:||||||||:...|.|.||||||.|||:..:||||.::.  ...:||
Zfish   173 GMITDTMFCAGYLEGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVC--MFSQWI 235

  Fly   263  262
            Zfish   236  235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/232 (35%)
Tryp_SPc 37..263 CDD:238113 84/233 (36%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 82/232 (35%)
Tryp_SPc 21..238 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.