DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG32376

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:255 Identity:85/255 - (33%)
Similarity:135/255 - (52%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQ 84
            :.|...:.:.|    :|||||:.....:.|:|.||..:...:||..|::..|.:||.||..|   
  Fly    53 INALEAQESFP----TRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG--- 110

  Fly    85 QPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPL--GK-VAPIR 146
            .|.::|:|.||..:..||.::.||.|....||:...|..|:|:::     |..|:  || |.|::
  Fly   111 PPEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMK-----LKSPVYFGKCVRPVK 170

  Fly   147 LPTVGEAISESMPA--VVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG-GVTEAMFC 208
            ||:..   :...|.  ||||||..|.:...:...|:...:..:.:.||....:..| .:.:.|.|
  Fly   171 LPSTK---TTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMIC 232

  Fly   209 AAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIRLLTKL 268
            |:..|.|:|.||||||::::|.|.||||||:|||:..|||||.     ..:|::..:.|:
  Fly   233 ASRTNKDSCSGDSGGPLTSRGVLYGIVSWGIGCANKNYPGVYV-----NCKRYVPWIKKV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/231 (35%)
Tryp_SPc 37..263 CDD:238113 81/231 (35%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 82/234 (35%)
Tryp_SPc 66..287 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.