DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk15

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:271 Identity:90/271 - (33%)
Similarity:126/271 - (46%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            :||:|.:|::..|         |...:::.|.|......|:|::|..:....|||.::|..|.:|
Mouse     2 WLLLAFVLLVSAA---------QDGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLT 57

  Fly    75 AAHCIDGHEQQPREFTLRQGS-IMRTSGGTVQ--PVKAIYKHPAYDRADMNFDVALLRTADGA-L 135
            ||||      |.|...:|.|. .:|...|..|  .|..|..||.|:......|:.|||....| |
Mouse    58 AAHC------QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARL 116

  Fly   136 SLPLGKVA-PIRLPTVGEAISESMPAVVSGWGHMSTSNP----------VLSSVLKSTTVLTVNQ 189
            :..:..|| |.|.|.:||      ..||||||.:|.:||          .|...|....:..:::
Mouse   117 TAYVRPVALPRRCPLIGE------DCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISE 175

  Fly   190 EKCHNDLRHHGGVTEAMFCAAAR--NTDACQGDSGGPISAQGTLIGIVSWG-VGCADPYYPGVYT 251
            ..|:.|  :.|.|...|.||...  .||:|:||||||:...|.|.|||||| |.|.....|||||
Mouse   176 ASCNKD--YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYT 238

  Fly   252 RLAHPTIRRWI 262
            ::.  :...||
Mouse   239 KVC--SYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 82/243 (34%)
Tryp_SPc 37..263 CDD:238113 84/244 (34%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 82/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.