DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG3795

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:125/294 - (42%) Gaps:56/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PIPFLLIAGILVILEASRTEA------AVPRQPDSR------IVNG--REATEGQFPYQLSLRRQ 57
            |..|::...::.:...|.:|:      :.|.|...|      :|.|  |..|.....|.:|||..
  Fly     3 PSKFVVYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMG 67

  Fly    58 TV-------HICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMRTSG--------GTVQPV 107
            ..       |.|..:|.|....:|||||:..:.::     |:...:|..:|        .|.|.:
  Fly    68 KPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRK-----LKAKKLMVVAGTPRRLLKSSTTQII 127

  Fly   108 KA--IYKHPAYDRA-DMNFDVAL-LRTADGALSLPLGKVAPI--RLPTVGEAISESMPAVVSGWG 166
            :|  :..||.|.:. ...:|:.| |..||.:|...:.|: |:  ::|..|      .|..:.|||
  Fly   128 EAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKI-PLYNKVPVAG------APCSIVGWG 185

  Fly   167 HMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAAR---NTDACQGDSGGPISAQ 228
            .:....|:....:.....: :....|...|   |.....|.||..:   :.|:||||||||:...
  Fly   186 TVIQFGPLPDEAINGDMQI-LPDTFCEKLL---GWSNAGMLCANDKHDSDVDSCQGDSGGPLICD 246

  Fly   229 GTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262
            ..:.||||:|:||.:|...|:||.:.|  .|.||
  Fly   247 NMVTGIVSFGMGCGEPDSAGIYTDVYH--FRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 70/257 (27%)
Tryp_SPc 37..263 CDD:238113 71/252 (28%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 67/237 (28%)
Tryp_SPc 60..278 CDD:214473 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.