DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and CG14780

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:272 Identity:87/272 - (31%)
Similarity:133/272 - (48%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAVPRQPDSRIVNGREATEGQFPYQLSLRR-------QTVHICGASILSSNWAITAAHCIDGHE- 83
            |.:.....|||:||..|...:..:.:|:|.       .:.||||.::::....:|||||:..:: 
  Fly    23 ADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQR 87

  Fly    84 ---QQPREFTLRQGSIMR---TSGGTVQPVKAI-YKHPAYDRADMNFDVALLRTADGALSLPLG- 140
               ::..||.:..|::.|   .:|..|..|.:: |.| .:....|..||.:|....|....|.| 
  Fly    88 KRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMH-TFSPDSMRDDVGILFLRTGLPMSPGGG 151

  Fly   141 ---KVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGV 202
               .||||:|  .|:.........|:|||....|:  ||::|.:..|.|:..:.|.  :.:..|:
  Fly   152 VHLTVAPIQL--AGQITPPGKLCQVAGWGRTEQSS--LSNILLTANVSTIRHQTCR--MIYRSGL 210

  Fly   203 TEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI--- 262
            ...|.||.  ...||:||||||||:..:|.|:|:||||.|||:|..||||..:.:  .|:||   
  Fly   211 LPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEY--YRQWIEGR 273

  Fly   263 ------RLLTKL 268
                  ||.|.|
  Fly   274 SGAPHSRLATGL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/246 (32%)
Tryp_SPc 37..263 CDD:238113 80/255 (31%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 79/246 (32%)
Tryp_SPc 33..271 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.