DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk12

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:267 Identity:83/267 - (31%)
Similarity:120/267 - (44%) Gaps:37/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITA 75
            ||:..::.:.:|.|          .:|.||.|..:...|:|:.|.......||..::...|.:||
  Rat     6 LLLLCVVGLSQADR----------EKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTA 60

  Fly    76 AHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMN--FDVALLRTADGALSLP 138
            |||...:..:..|.:|.:..:......|...:    .||:|..|..|  .|:.|||     |:.|
  Rat    61 AHCSGKYMVRLGEHSLSKLDLTEQLRLTTFSI----THPSYHGAYQNHEHDLRLLR-----LNRP 116

  Fly   139 LG---KVAPIRLPTVGEAISESMPAVVSGWGHMSTSNP--VLSSVLKSTTVLTVNQEKCHNDLRH 198
            :.   .|.|:.||:  ..........:||||  :|:.|  .....|:...:..|:.|.|.  ...
  Rat   117 ISLTYAVRPVALPS--SCAPTGAKCHISGWG--TTNKPWDPFPDRLQCLDLSIVSNETCR--AVF 175

  Fly   199 HGGVTEAMFCAAAR-NTDACQGDSGGPISAQGTLIGIVSWG-VG-CADPYYPGVYTRLAHPTIRR 260
            .|.|||.|.||... ..||||||||||:...|.|.|:|||| || |.....|||||::...|  .
  Rat   176 PGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYT--D 238

  Fly   261 WIRLLTK 267
            |||::.:
  Rat   239 WIRVVIR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/235 (32%)
Tryp_SPc 37..263 CDD:238113 77/235 (33%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.