DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss22

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:293 Identity:87/293 - (29%)
Similarity:143/293 - (48%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFLLIAG-------ILVILEASRTEAA--VPRQPD-------SRIVNGREATEGQFPYQLSLRRQ 57
            |.|.:.|       :||:|.::.|.:|  :...||       :|:|.|.::.:.|:|:.:|:.:.
  Rat     6 PPLALGGDQFRTLILLVLLTSTATVSAANIRGSPDCGKPQQLNRVVGGEDSADAQWPWIVSILKN 70

  Fly    58 TVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGS-IMRTSGGTVQPV--KAIYKHPAYDRA 119
            ..|.|..|:|::.|.::||||...:..:|..:::..|: .:...|...|.|  .::..||.|.|.
  Rat    71 GSHHCAGSLLTNRWVVSAAHCFSSNMDKPSPYSVLLGAWKLGNPGPRSQKVGIASVLPHPRYSRK 135

  Fly   120 D-MNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPV-LSSVL 179
            : .:.|:||:|     |..|:   .::.||.||.....:..:....::|||.:....|: ....|
  Rat   136 EGTHADIALVR-----LERPIQFSERILPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTL 195

  Fly   180 KSTTVLTVNQEKCHNDLRHHGG---VTEAMFCAA--ARNTDACQGDSGGPISAQ----GTLIGIV 235
            :...|..::.|.|.:......|   :||.|.||.  ....|||.||||||:..|    ..|.||:
  Rat   196 QKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGII 260

  Fly   236 SWGVGCADPYYPGVYTR-LAHPTIRRWIRLLTK 267
            |||.|||:...|||||. |||   |.|::.:.:
  Rat   261 SWGEGCAERNRPGVYTSLLAH---RPWVQRIVQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/243 (31%)
Tryp_SPc 37..263 CDD:238113 76/243 (31%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 76/243 (31%)
Tryp_SPc 50..288 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.