DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk9

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:240 Identity:74/240 - (30%)
Similarity:114/240 - (47%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFT-LRQGSIM 97
            |:|.|..||......|:|..|...|..:|||::::..|.:|||||     ::|..:. |.:..:.
  Rat    20 DTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC-----RKPYLWVRLGEHHLW 79

  Fly    98 RTSGGTVQPVKAI-----YKHPAYD----RADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEA 153
            :..|    |.|.:     :.||.::    ..|.|.|:.|:|........|  .|.|:.|      
  Rat    80 QWEG----PEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLSP--AVQPLNL------ 132

  Fly   154 ISESMPAV-----VSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--A 211
             |:|:|:|     :||||.:|:|.......|:...:..::.:.|.  ..:.|.::|.|.||.  .
  Rat   133 -SQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCR--WAYPGHISEKMLCAGLWE 194

  Fly   212 RNTDACQGDSGGPISAQGTLIGIVSWG-VGCADPYYPGVYTRLAH 255
            ....:||||||||:..:|||.||||.| ..|:.|..|.|||.:.|
  Rat   195 GGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFH 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 73/238 (31%)
Tryp_SPc 37..263 CDD:238113 72/237 (30%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.