DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk10

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:234 Identity:71/234 - (30%)
Similarity:106/234 - (45%) Gaps:38/234 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPR----EFTLRQGSIMRTSGGTVQPVKA 109
            |:|:||.......|...::..||.:|||||......:.|    ...|.|...:|::...|     
  Rat    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLLLFQSEQLRSTNSPV----- 118

  Fly   110 IYKHPAYD---------RADMNFDVALLRTADGALSLPL---GKVAPIRLPTVGEAISESMPAVV 162
              .||.|.         |:| ..|:.:|:     ||.|:   .||.|::||.  :.........|
  Rat   119 --FHPKYQPCSGPVLPLRSD-EHDLMMLK-----LSSPVVLTSKVHPVQLPF--QCAQPRQECQV 173

  Fly   163 SGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAA-RNTDACQGDSGGPIS 226
            ||||..:......:..|..:.|..::|::|  :..:.|.:|..|.||.. |:.|:||.|||||:.
  Rat   174 SGWGTTANRRVKYNRSLSCSRVTLLSQKQC--ETFYPGVITNNMICAGMDRDQDSCQSDSGGPLV 236

  Fly   227 AQGTLIGIVSWGV-GC-ADPYYPGVYTRLAHPTIRRWIR 263
            ...||.||:||.: .| |...||.||.::.:.|  .|||
  Rat   237 CDNTLHGILSWSIYPCGAATQYPAVYAKICNYT--NWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 68/231 (29%)
Tryp_SPc 37..263 CDD:238113 69/232 (30%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 68/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.