DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Klk11

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:240 Identity:70/240 - (29%)
Similarity:122/240 - (50%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMR 98
            ::||:.|.|......|:|::|.::|..:|||::::..|.:|||||...|    ....|.:.::.:
  Rat    48 ETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPH----YVILLGEHNLEK 108

  Fly    99 TSGGTVQPVKA-IYKHPAYDRA----DMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISESM 158
            |.|...:.:.. .:.||.::.:    |...|:.|::.:..|..  ...|.|:.|.::  .::...
  Rat   109 TDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFI--TRAVRPLTLSSL--CVTAGT 169

  Fly   159 PAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAAR--NTDACQGDS 221
            ..::||||..|:....|...|:...|..:..::|  :..:.|.:|:.|.||:.|  ..|:|||||
  Rat   170 SCLISGWGTTSSPQLRLPHSLRCANVSIIGHKEC--ERAYPGNITDTMLCASVRKEGKDSCQGDS 232

  Fly   222 GGPISAQGTLIGIVSWGVG-CADPYYPGVYTRLA------HPTIR 259
            |||:...|:|.||:|||.. ||....|||||::.      |..:|
  Rat   233 GGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHEVMR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 70/238 (29%)
Tryp_SPc 37..263 CDD:238113 69/237 (29%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 68/231 (29%)
Tryp_SPc 51..275 CDD:238113 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.