DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:274 Identity:90/274 - (32%)
Similarity:132/274 - (48%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILVILE----ASRTEAA-VPRQPDSRIVNGREATEGQFPYQLSLRRQ---TVHICGASILSSNWA 72
            :|::|.    ||...|| .|.:....||.||||:|.::|:|:|||.:   .:|.||.|::...|.
  Rat     4 LLLLLALSPLASLVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWV 68

  Fly    73 ITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSL 137
            :|||||:..|.:.|..|.::...........:..|.....||.|...:...|:|||.     |..
  Rat    69 LTAAHCVGLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLE-----LEN 128

  Fly   138 PLG---KVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSV-LKSTTVLTVNQEKCHNDLRH 198
            |:.   .:.|..||...|.........|:|||.:.:..|:|... ||...|..|....|  |.::
  Rat   129 PVNVSTHIHPTSLPPASETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLC--DRKY 191

  Fly   199 HGG---------VTEAMFCAAARNTDACQGDSGGPI--SAQGTLI--GIVSWGVGCADPYYPGVY 250
            |.|         |.:.|.||....:|:||||||||:  ..:||.:  |:||||.|||:...||:|
  Rat   192 HTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPGIY 256

  Fly   251 TRLAH--PTIRRWI 262
            ||:.:  ..|.|::
  Rat   257 TRVTYYLDWIHRYV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/247 (34%)
Tryp_SPc 37..263 CDD:238113 83/248 (33%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 82/244 (34%)
Tryp_SPc 30..266 CDD:214473 81/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.