DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss34

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:262 Identity:81/262 - (30%)
Similarity:122/262 - (46%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAVPRQPDS-----RIVNGREATEGQFPYQLSLRRQTV------HICGASILSSNWAITAAHCID 80
            :.:|..|||     .||.|...:..:||:|:|||...:      ||||.|::...|.:|||||::
  Rat    18 STMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVE 82

  Fly    81 GHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDR---ADMNFDVALLRTADGALSLPLGKV 142
            ..|.:...|.::.|.:.......:..|..|.:||.:..   |....|:|||: .|..:.|. .:|
  Rat    83 LKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLK-LDSTVVLS-ERV 145

  Fly   143 APIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSV-LKSTTVLTVNQEKCHNDLRHHGG----- 201
            .|:.||...:.||......|:|||.:....|:.... |:...|..|....|....|.:..     
  Rat   146 HPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTT 210

  Fly   202 --VTEAMFCAAARNTDACQGDSGGPI----SAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRR 260
              :.:.|.||.....|:||.|||||:    :.....:|:||||:||..|.:||||||:.  :...
  Rat   211 KIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVM--SYLS 273

  Fly   261 WI 262
            ||
  Rat   274 WI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 75/246 (30%)
Tryp_SPc 37..263 CDD:238113 77/247 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 77/247 (31%)
Tryp_SPc 33..275 CDD:214473 75/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.