DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss29

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:263 Identity:90/263 - (34%)
Similarity:125/263 - (47%) Gaps:36/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLR------RQTVHICGASILSSNW 71
            ||||         .|:||......||.|..|.:|::|:|:|||      ...|||||.||:...|
  Rat    16 IAGI---------PASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQW 71

  Fly    72 AITAAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALS 136
            .:||||||...:..|..|.:..|.:....|..:..|..:..||.:.|:.:..|||||:.|....|
  Rat    72 VLTAAHCIHESDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRS 136

  Fly   137 LPLGKVAPIRLPTVGEAISESMPAVVSGWG----HMSTSNPVLSSVLKSTTVLTVNQEKCH---- 193
            .|  .|.|::|......:::.....|:|||    |.|...|..   |:...|..|:...|.    
  Rat   137 FP--NVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYR---LQQVQVKIVDNTLCEKLYR 196

  Fly   194 --NDLRHHGG--VTEAMFCAAARNTDACQGDSGGP----ISAQGTLIGIVSWGVGCADPYYPGVY 250
              ..|.:||.  :.:.|.||.:...|:|.||||||    ::...||:|:||||.|||....||||
  Rat   197 NATRLSNHGQRLILQDMLCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVY 261

  Fly   251 TRL 253
            .|:
  Rat   262 ARV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/240 (35%)
Tryp_SPc 37..263 CDD:238113 83/239 (35%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.