DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss30

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:279 Identity:94/279 - (33%)
Similarity:140/279 - (50%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTV-HICGASILSSNWAI 73
            |||   :|.||...|.:  :......:||.|::|.||::|:|:|||.:.. ||||.|::...|.:
  Rat     9 FLL---LLQILTGGRGD--ILHSGAGKIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVL 68

  Fly    74 TAAHCIDGHEQQPRE---FTLRQGSI---MRTSGGTVQPVKAIYKHPAYDRADMNF-DVALLRTA 131
            |||||.    .:|..   :.::.|.:   :.....|:..|:.|:.:|.|...|.:. |:||||  
  Rat    69 TAAHCF----CRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLR-- 127

  Fly   132 DGALSLPL--GKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHN 194
               |..||  .:.:|:.||.....::......|:|||  :|....|:|||:...|..::.|.|  
  Rat   128 ---LDTPLQPSQFSPVCLPQAQAPLTPGTVCWVTGWG--ATHERELASVLQELAVPLLDSEDC-- 185

  Fly   195 DLRHHGGVTEA---------MFCA--AARNTDACQGDSGGP----ISAQGTLIGIVSWGVGCADP 244
            :..:|.|.|..         |.||  .....|:||||||||    |::....:||.|||:|||.|
  Rat   186 ERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARP 250

  Fly   245 YYPGVYTRLAHPTIRRWIR 263
            ..||||||:  |....||:
  Rat   251 NKPGVYTRV--PDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 85/250 (34%)
Tryp_SPc 37..263 CDD:238113 86/250 (34%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.