DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and LOC286960

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:242 Identity:76/242 - (31%)
Similarity:117/242 - (48%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLR 92
            |:|...|.:||.|....:...|||:||.....|.||.|::|..|.::||||      ..|:..:|
  Rat    15 ALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC------YKRKLQVR 73

  Fly    93 QG--SIMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEA 153
            .|  :|....||. |.:.|  |.:||.|::..::.|:.|::....|:.  ..:|:.:.||.  ..
  Rat    74 LGEHNIHVLEGGE-QFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVL--NSQVSTVSLPR--SC 133

  Fly   154 ISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAA--ARNTDA 216
            .|.....:|||||:..:......::|:......::...|...  :.|.:|..|||..  ....|:
  Rat   134 ASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKS--YPGQITSNMFCLGFLEGGKDS 196

  Fly   217 CQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263
            |.||||||:...|.:.||||||..||....|||||::.:  ...||:
  Rat   197 CDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCN--YLSWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/231 (31%)
Tryp_SPc 37..263 CDD:238113 72/231 (31%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 71/231 (31%)
Tryp_SPc 24..243 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.