DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Prss3b

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:262 Identity:84/262 - (32%)
Similarity:124/262 - (47%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAIT 74
            ||...|..|.|...        ..|.:||.|....:...|||:|| ....|.||.|:::|.|.::
  Rat     6 FLAFLGAAVALPLD--------DDDDKIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLINSQWVVS 61

  Fly    75 AAHCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKA--IYKHPAYDRADMNFDVALLRTADGALSL 137
            ||||.....|    ..|.:.:|....||. |.:.|  |.:||:|:....:.|:.|::     |:.
  Rat    62 AAHCYKSRIQ----VRLGEHNIDVVEGGE-QFIDAAKIIRHPSYNANTFDNDIMLIK-----LNS 116

  Fly   138 PL---GKVAPIRLP-TVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRH 198
            |.   .:|:.:.|| :.|   |.....:|||||:..:|.....|:|:......::...|.:.  :
  Rat   117 PATLNSRVSTVSLPRSCG---SSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSS--Y 176

  Fly   199 HGGVTEAMFCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRW 261
            .|.:|..|||..  ....|:||||||||:...|.|.|:||||.|||....|||||::.:..  .|
  Rat   177 PGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYV--NW 239

  Fly   262 IR 263
            |:
  Rat   240 IQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 76/233 (33%)
Tryp_SPc 37..263 CDD:238113 77/233 (33%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 76/233 (33%)
Tryp_SPc 25..243 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.