DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and KLK9

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:253 Identity:72/253 - (28%)
Similarity:108/253 - (42%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHC----------------IDGH 82
            |:|.:...|......|:|..|...|...|||:::|..|.:|||||                .:|.
Human    20 DTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLWVRLGEHHLWKWEGP 84

  Fly    83 EQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDR----ADMNFDVALLRTADGALSLPLGKVA 143
            ||..|                   |...:.||.:::    .|.|.|:.|:|....|...|  .|.
Human    85 EQLFR-------------------VTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSP--AVQ 128

  Fly   144 PIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFC 208
            |:.|...  .:|..|..::||||.:|:...:....|:...:..:..:.||  ..:.|.::::|.|
Human   129 PLNLSQT--CVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCH--WAYPGHISDSMLC 189

  Fly   209 AA--ARNTDACQGDSGGPISAQGTLIGIVSWGV-GCADPYYPGVYTRLAHPTIRRWIR 263
            |.  .....:||||||||:...|||.|:||.|. .|:.|..|.|||.:.|  ...||:
Human   190 AGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCH--YLDWIQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 69/248 (28%)
Tryp_SPc 37..263 CDD:238113 69/248 (28%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.