DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10405 and Gzma

DIOPT Version :9

Sequence 1:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:249 Identity:78/249 - (31%)
Similarity:118/249 - (47%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQ 93
            :|.....||:.|........||.:.|:.:...||..::::.||.:||||||.|.:.   |..|..
  Rat    21 IPEGGCERIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKNWVLTAAHCIPGKKS---EVILGA 82

  Fly    94 GSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGK-VAPIRLPTVGEAISES 157
            .||.:.....:..||..|.:|.:|:.....|:.|||....|   .|.| ||.:.||..|:.:...
  Rat    83 HSIKKEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKA---TLNKNVAILHLPKKGDDVKPG 144

  Fly   158 MPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHG-----GVTEAMFCAA--ARNTD 215
            ....|:|||.....:|. |..|:...:..::::.| ||.:|:.     |:.  |.||.  ....|
  Rat   145 TRCHVAGWGRFHNKSPP-SDTLREVNITVIDRKIC-NDEKHYNFNPVIGLN--MICAGNLRGGKD 205

  Fly   216 ACQGDSGGPISAQGTLIGIVSWGV--GCADPYYPGVYTRLAHPTIRRWIRLLTK 267
            :|.||||||:..:|...||.::|:  .|.||..||:||.|:...: .|||...|
  Rat   206 SCYGDSGGPLLCEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHL-DWIRKTAK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 73/235 (31%)
Tryp_SPc 37..263 CDD:238113 73/235 (31%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 73/235 (31%)
Tryp_SPc 29..256 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.